PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07872A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 412aa    MW: 45581.4 Da    PI: 5.1164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07872AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-17120166148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g WT+eEd +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  Oropetium_20150105_07872A 120 KGQWTPEEDRKLVELVEQFGLRKWSCIAQFLP-GRVGKQCIERWHNHL 166
                                799*****************************.*************97 PP

2Myb_DNA-binding52.11.5e-16189229345
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                 W+ eEd  l++a+++ G++ W+ Ia++++ gRt++++k++w+
  Oropetium_20150105_07872A 189 IWSDEEDMVLIEAHREVGNR-WAEIAKRLP-GRTENSIKNHWN 229
                                6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.875115170IPR017930Myb domain
SuperFamilySSF466891.8E-29119228IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-23119169IPR009057Homeodomain-like
SMARTSM007176.6E-15119168IPR001005SANT/Myb domain
PfamPF002494.7E-16120166IPR001005SANT/Myb domain
CDDcd001674.25E-15123166No hitNo description
PROSITE profilePS5129418.932182236IPR017930Myb domain
SMARTSM007171.1E-15186234IPR001005SANT/Myb domain
CDDcd001678.22E-14190232No hitNo description
Gene3DG3DSA:1.10.10.602.2E-18190230IPR009057Homeodomain-like
PfamPF002495.4E-15190229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
QNGLYELHPV DHHQFDGVGE YSYYTSSGSV LPSAAAFNDL GHQYQYYSER EETNRPGASS  60
VDPNNVLTLA TPKPEVCHRV VQSGFIGSYK AYENETTNRF APRKKAAGST SSKKTNVVTK  120
GQWTPEEDRK LVELVEQFGL RKWSCIAQFL PGRVGKQCIE RWHNHLRPDI KVQSLNLYLK  180
CFQIDVKDIW SDEEDMVLIE AHREVGNRWA EIAKRLPGRT ENSIKNHWNA TKRRQFAARR  240
RRSSSSSTSK RKQGPKSSGT SSTLLQKYIE SLGTGPGNKN SAPSSSSRLL DQPSASAPLD  300
LEPEQHNREP NNDSVLLLLE VEAQGVRLGI YEESNCAGDD DDFSVDMLCG SLLFDGALRE  360
DQDAAAAVDE ADGVGGDSVL NHLNFGVDED LINVDMALAW DGDDDALGFA C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-401172351104C-Myb DNA-Binding Domain
1msf_C2e-401172351104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231241KRRQFAARRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441884.17e-86hypothetical protein SORBIDRAFT_08g004250
TrEMBLC5YSM17e-86C5YSM1_SORBI; Putative uncharacterized protein Sb08g004250
STRINGSb08g004250.12e-85(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-51myb domain protein 98